Antibodies

Jump to Filters
View as table Download
MYH10 Rabbit Polyclonal Antibody
TA346425

USD 475.00

5 Days

Rabbit Polyclonal Anti-MYH10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MYH10 antibody: synthetic peptide directed towards the N terminal of human MYH10. Synthetic peptide located within the following region: WFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKAD
MYH10 Rabbit Polyclonal Antibody
TA378830

USD 220.00

3 Weeks

MYH10 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1908-2007 of human MYH10 (NP_001242941.1).
Modifications Unmodified