Germany
Japan
United Kingdom
China
Myosin (MYL4) mouse monoclonal antibody, clone AT4E8, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Antibodies
View as table Download
Myosin (MYL4) mouse monoclonal antibody, clone AT4E8, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Rabbit Polyclonal Anti-MYL4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MYL4 Antibody: synthetic peptide directed towards the N terminal of human MYL4. Synthetic peptide located within the following region: MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTA |
MYL4 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-197 of human MYL4 (NP_002467.1). |
| Modifications | Unmodified |
MYL4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-197 of human MYL4 (NP_002467.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- MYL4