Antibodies

Jump to Filters
View as table Download
Myosin 1C (MYO1C) Rabbit Polyclonal Antibody
TA335419

USD 375.00

5 Days

Rabbit Polyclonal Anti-MYO1C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MYO1C Antibody: synthetic peptide directed towards the N terminal of human MYO1C. Synthetic peptide located within the following region: NPVLEAFGNAKTLRNDNSSRFGKYMDVQFDFKGAPVGGHILSYLLEKSRV
Myosin 1C (MYO1C) Rabbit Polyclonal Antibody
TA378868

USD 220.00

3 Weeks

MYO1C Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 769-1028 of human MYO1C (NP_203693.3).
Modifications Unmodified