Germany
Japan
United Kingdom
China
MYO1E (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 227-257aa) of human Myosin-Ie |
Antibodies
View as table Download
Rabbit polyclonal Anti-MYO1E Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYO1E antibody: synthetic peptide directed towards the middle region of human MYO1E. Synthetic peptide located within the following region: PKPQPKPKPQVPQCKALYAYDAQDTDELSFNANDIIDIIKEDPSGWWTGR |
MYO1E Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 809-1108 of human MYO1E (NP_004989.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- MYO1E