Antibodies

Jump to Filters
View as table Download
MRF (MYRF) Rabbit Polyclonal Antibody
TA335643

USD 375.00

In Stock

Rabbit Polyclonal Anti-MYRF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-C11orf9 Antibody: synthetic peptide directed towards the N terminal of human C11orf9. Synthetic peptide located within the following region: GTGPPIKAEPKAPYAPGTLPDSPPDSGSEAYSPQQVNEPHLLRTITPETL
MRF (MYRF) Rabbit Polyclonal Antibody
TA378886

USD 220.00

3 Weeks

MYRF Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MYRF (NP_001120864.1).
Modifications Unmodified