Antibodies

Jump to Filters
View as table Download
Myeloid zinc finger 1 (MZF1) Rabbit Polyclonal Antibody
TA314689

USD 345.00

4 Weeks

Rabbit polyclonal anti-MZF-1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human MZF-1.
Myeloid zinc finger 1 (MZF1) Rabbit Polyclonal Antibody
TA343390

USD 375.00

5 Days

Rabbit Polyclonal Anti-MZF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MZF1 antibody: synthetic peptide directed towards the N terminal of human MZF1. Synthetic peptide located within the following region: RPAVLGSPDRAPPEDEGPVMVKLEDSEEEGEAALWDPGPEAARLRFRCFR
Myeloid zinc finger 1 (MZF1) Rabbit Polyclonal Antibody
TA378891

USD 220.00

3 Weeks

MZF1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-350 of human MZF1 (NP_003413.2).
Modifications Unmodified