Antibodies

Jump to Filters
View as table Download
Methionyl tRNA synthetase (MARS) Rabbit Polyclonal Antibody
TA331113

USD 375.00

5 Days

Rabbit Polyclonal Anti-MARS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MARS antibody: synthetic peptide directed towards the middle region of human MARS. Synthetic peptide located within the following region: GHQIGTVSPLFQKLENDQIESLRQRFGGGQAKTSPKPAVVETVTTAKPQQ
Methionyl tRNA synthetase (MARS) Rabbit Polyclonal Antibody
TA378346

USD 220.00

3 Weeks

MARS Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human MARS (NP_004981.2).
Modifications Unmodified