Rabbit Polyclonal Anti-MATR3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MATR3 antibody: synthetic peptide directed towards the N terminal of human MATR3. Synthetic peptide located within the following region: MSKSFQQSSLSRDSQGHGRDLSAAGIGLLAAATQSLSMPASLGRMNQGTA |
Rabbit Polyclonal Anti-MATR3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MATR3 antibody: synthetic peptide directed towards the C terminal of human MATR3. Synthetic peptide located within the following region: ADDPNKDTSENADGQSDENKDDYTIPDEYRIGPYQPNVPVGIDYVIPKTG |
Rabbit Polyclonal Anti-MATR3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MATR3 |
MATR3 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MATR3 |
Matrin 3 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 747-847 of human Matrin 3 (NP_001181884.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
