Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-MB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MB antibody: synthetic peptide directed towards the N terminal of human MB. Synthetic peptide located within the following region: MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHL |
Myoglobin (MB) mouse monoclonal antibody, clone JAN-12, Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Rat |
Rabbit polyclonal anti-MB (myoglobin) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human MB. |
Mouse monoclonal Myoglobin Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit anti Myoglobin Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Myoglobin Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
MB rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
MB rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MB |
MB rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Myoglobin Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | RecoMyoglobin inant fusion protein containing a sequence corresponding to amino acids 1-154 of human Myoglobin (NP_005359.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- MB