Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-MBP(myelin basic protein) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MBP(myelin basic protein) Antibody: Peptide sequence around aa.291~295(G-G-R-D-S |
Antibodies
View as table Download
Mouse Monoclonal MBP Antibody (2H9)
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TA336919 is a replacement of AM06698SU-N.
Rabbit Polyclonal Anti-MBP Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MBP Antibody: synthetic peptide directed towards the middle region of human MBP. Synthetic peptide located within the following region: FGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIV |
Myelin Basic Protein (MBP) chicken polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide KLH conjugated corresponding to a region of the MBP gene product shared between the Human (NP_002376) and Mouse (NP_034907) sequences. After repeated injections, immune eggs were collected, the IgY fractions were purified from the yolks, and then affinity-purified using a peptide column. |
Rabbit Polyclonal MBP Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Reacts with residues 49-62 of Isoforms 5 and 6 of the human protein. The immunogen corresponds to Isoform 1 between amino acids 182-195 of the 33 kDa isoform. The antibody also detects mouse and rat MBP protein. The antibody primarily detects a 22 kDa ban |
Anti-MBP Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.291~295(G-G-R-D-S)derived from Human MBP |
Rabbit Polyclonal Anti-MBP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MBP Antibody: synthetic peptide directed towards the middle region of human MBP. Synthetic peptide located within the following region: FKDRPSESDELQTIQEDSAATSESLDVMASQKRPSQRHGSKYLATASTMD |
Rabbit anti Myelin Basic Protein Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti MBP Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti MBP (Paired T98) Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti MBP(pT98) Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Myelin Basic Protein Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
MBP rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MBP |
USD 380.00
4 Weeks
Myelin Basic Protein (10D5) Mouse monoclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 380.00
4 Weeks
Myelin Basic Protein Rabbit monoclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
USD 380.00
4 Weeks
Myelin Basic Protein Rabbit monoclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- MBP