Antibodies

Jump to Filters
View as table Download
MCM9 Rabbit Polyclonal Antibody
TA341692

USD 375.00

5 Days

Rabbit Polyclonal Anti-MCM9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MCM9 antibody: synthetic peptide directed towards the N terminal of human MCM9. Synthetic peptide located within the following region: NSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETN
MCM9 Rabbit Polyclonal Antibody
TA368849

USD 380.00

4 Weeks

MCM9 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MCM9