Antibodies

Jump to Filters
View as table Download
Mucolipin 3 (MCOLN3) Rabbit Polyclonal Antibody
TA331465

USD 375.00

In Stock

Rabbit polyclonal Anti-MCOLN3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MCOLN3 antibody: synthetic peptide directed towards the middle region of human MCOLN3. Synthetic peptide located within the following region: ENKLNLTLDFHRLLTVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNK
Mucolipin 3 (MCOLN3) Rabbit Polyclonal Antibody
TA338583

USD 375.00

In Stock

Rabbit Polyclonal Anti-MCOLN3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MCOLN3 antibody: synthetic peptide directed towards the middle region of human MCOLN3. Synthetic peptide located within the following region: TVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNKAHSGRIKISLDNDI
Mcoln3 Rabbit Polyclonal Antibody
TA328759

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-TRPML3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide CKDLPNSGKYRLEDD, corresponding to amino acid residues 528-542 of mouse TRPML3. Intracellular, C-terminus (cytoplasmic).