Rabbit polyclonal MDC1 (Ser513) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MDC1 around the phosphorylation site of serine 513 (L-E-R-SP-Q). |
| Modifications | Phospho-specific |
Mouse Monoclonal Anti-MDC1 Antibody
| Reactivities | Bovine, Chimpanzee, Human, Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-MDC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MDC1 antibody: synthetic peptide directed towards the C terminal of human MDC1. Synthetic peptide located within the following region: GKEEDVVTPKPGKRKRDQAEEEPNRIPSRSLRRTKLNQESTAPKVLFTGV |
Anti-MDC1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1866-1881 amino acids of Human mediator of DNA-damage checkpoint 1 |
MDC1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MDC1 (NP_055456.2). |
| Modifications | Unmodified |
MDC1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-350 of human MDC1 (NP_055456.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China