Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-MEOX2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MEOX2. |
Rabbit polyclonal MEOX2 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MEOX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 164-192 amino acids from the Central region of human MEOX2. |
Rabbit Polyclonal Anti-MEOX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MEOX2 antibody: synthetic peptide directed towards the N terminal of human MEOX2. Synthetic peptide located within the following region: ATAQGLHPFSQSSLALHGRSDHMSYPELSTSSSSCIIAGYPNEEGMFASQ |
Rabbit Polyclonal Anti-MEOX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MEOX2 antibody: synthetic peptide directed towards the N terminal of human MEOX2. Synthetic peptide located within the following region: MEHPLFGCLRSPHATAQGLHPFSQSSLALHGRSDHMSYPELSTSSSSCII |
Rabbit Polyclonal Anti-MEOX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MEOX2 antibody: synthetic peptide directed towards the C terminal of human MEOX2. Synthetic peptide located within the following region: REKELVNVKKGTLLPSELSGIGAATLQQTGDSIANEDSHDSDHSSEHAHL |
Carrier-free (BSA/glycerol-free) MEOX2 mouse monoclonal antibody, clone OTI4F6 (formerly 4F6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
MEOX2 mouse monoclonal antibody, clone OTI4F6 (formerly 4F6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
MEOX2 mouse monoclonal antibody, clone OTI4F6 (formerly 4F6), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
MEOX2 mouse monoclonal antibody, clone OTI4F6 (formerly 4F6), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
MEOX2 mouse monoclonal antibody, clone OTI4F6 (formerly 4F6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- MEOX2