Antibodies

Jump to Filters
View as table Download
Methionyl Aminopeptidase 1 (METAP1) Rabbit Polyclonal Antibody
TA333843

USD 375.00

5 Days

Rabbit Polyclonal Anti-METAP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-METAP1 Antibody: synthetic peptide directed towards the N terminal of human METAP1. Synthetic peptide located within the following region: GDINTDPWAGYRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQ
Methionyl Aminopeptidase 1 (METAP1) Rabbit Polyclonal Antibody
TA378473

USD 220.00

3 Weeks

METAP1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 177-386 of human METAP1 (NP_055958.2).
Modifications Unmodified