Antibodies

Jump to Filters
View as table Download
Mettl4 Rabbit Polyclonal Antibody
TA346820

USD 475.00

5 Days

Rabbit Polyclonal Anti-Mettl4 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Mettl4 antibody: synthetic peptide directed towards the C terminal of human Mettl4. Synthetic peptide located within the following region: SGEFVFPLDSLHKKPYECLVLGRVKEKTALALRNEAVRTPPVPDQRLIVS
METTL4 (C-term) Rabbit Polyclonal Antibody
AP52676PU-N

USD 450.00

2 Weeks

METTL4 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 322-352 amino acids from the C-terminal region of human METTL4
METTL4 Rabbit Polyclonal Antibody
TA378483

USD 220.00

3 Weeks

METTL4 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human METTL4 (NP_073751.3).
Modifications Unmodified