Germany
Japan
United Kingdom
China
Goat Anti-CBARA1 (aa113-126) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EYENRIRAYSTPDK, from the internal region of the protein sequence according to NP_006068.2; NP_001182447.1. |
Antibodies
View as table Download
CBARA1 (MICU1) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 59~89 amino acids from the N-terminal region of human CBAA1 |
Rabbit Polyclonal Anti-MICU1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MICU1 antibody is: synthetic peptide directed towards the C-terminal region of Human MICU1. Synthetic peptide located within the following region: LSDHVCDVVFALFDCDGNGELSNKEFVSIMKQRLMRGLEKPKDMGFTRLM |
MICU1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CBARA1 |
MICU1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CBARA1 |
MICU1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MICU1 |
Active filters
Target Symbol
- MICU1