Antibodies

View as table Download

Rabbit polyclonal anti-TRI18/MID1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TRI18.

Rabbit Polyclonal Anti-MID1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MID1 antibody is: synthetic peptide directed towards the N-terminal region of Human MID1. Synthetic peptide located within the following region: PTCRHVITLSQRGLDGLKRNVTLQNIIDRFQKASVSGPNSPSETRRERAF

Rabbit Polyclonal Anti-TRI18 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TRI18 Antibody: A synthesized peptide derived from human TRI18

Rabbit Polyclonal Anti-MID1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MID1 antibody: synthetic peptide directed towards the C terminal of human MID1. Synthetic peptide located within the following region: AINQAGSRSSEPGKLKTNSQPFKLDPKSAHRKLKVSHDNLTVERDESSSK

MID1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 478-667 of human MID1 (NP_000372.1).
Modifications Unmodified