Germany
Japan
United Kingdom
China
Rabbit anti-MIF Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MIF |
Antibodies
View as table Download
MIF rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MIF |
Rabbit polyclonal anti-macrophage migration inhibitory factor (MIF) antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 67 of human MIF |
Chicken polyclonal anti-MIF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IgY fraction antibody was prepared from eggs of chickens laid after repeated immunizations with a synthetic peptide corresponding to aa 2-32 of Human MIF conjugated to keyhole limpet hemocyanin (KLH). MIF is a proinflammatory cytokine that plays an important role in systemic inflammatory events. |
Rabbit Polyclonal Anti-MIF Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MIF antibody: synthetic peptide directed towards the middle region of human MIF. Synthetic peptide located within the following region: PQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLL |
MIF rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MIF |
MIF Rabbit monoclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- MIF