Antibodies

Jump to Filters
View as table Download
MAP4K6 (MINK1) Rabbit Polyclonal Antibody
TA315416

USD 345.00

In Stock

Rabbit polyclonal anti-MAP4K6 (MINK1) antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MAP4K6.
MAP4K6 (MINK1) Rabbit Polyclonal Antibody
TA331130

USD 375.00

5 Days

Rabbit Polyclonal Anti-MINK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MINK1 antibody: synthetic peptide directed towards the middle region of human MINK1. Synthetic peptide located within the following region: PDSSPVLSPGNKAKPDDHRSRPGRPADFVLLKERTLDEAPRPPKKAMDYS