Germany
Japan
United Kingdom
China
MMP9 rabbit monoclonal antibody, clone EP1255Y, Supernatant
| Applications | IF, IHC, WB |
| Reactivities | Guinea Pig, Human |
Antibodies
View as table Download
Rabbit polyclonal MITF (Ab-180/73) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human MITF around the phosphorylation site of serine 180/73 (P-N-SP-P-M). |
Rabbit polyclonal MITF (Ser180/73) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MITF around the phosphorylation site of serine 73 (P-N-SP-P-M). |
| Modifications | Phospho-specific |
Rabbit Polyclonal MITF (Ser180/73) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MITF around the phosphorylation site of Serine 180/73 |
| Modifications | Phospho-specific |
Rabbit Polyclonal MITF Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MITF |
MITF mouse monoclonal antibody, clone C5+D5, Supernatant
| Applications | IHC |
| Reactivities | Human |
Rabbit Polyclonal Anti-MITF Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MITF antibody: synthetic peptide directed towards the middle region of human MITF. Synthetic peptide located within the following region: MGSKLEDILMDDTLSPVGVTDPLLSSVSPGASKTSSRRSSMSMEETEHTC |
MLH1 mouse monoclonal antibody, clone G168-728, Supernatant
| Applications | IHC |
| Reactivities | Hamster, Human, Mouse, Rat |
MSH2 mouse monoclonal antibody, clone G219-1129, Supernatant
| Applications | IHC |
| Reactivities | Human |
EMA (MUC1) mouse monoclonal antibody, clone MRQ-17, Supernatant
| Applications | IHC |
| Reactivities | Human, Mouse |
Mucin 5AC (MUC5AC) mouse monoclonal antibody, clone MRQ-19, Supernatant
| Applications | IHC |
| Reactivities | Human |
Gastric Mucin (MUC6) mouse monoclonal antibody, clone MRQ-20, Supernatant
| Applications | IHC |
| Reactivities | Human |
MITF Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MITF |
Rabbit Polyclonal anti-MITF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MITF antibody is: synthetic peptide directed towards the middle region of Human MITF. Synthetic peptide located within the following region: NSNCEKEGFYKFEEQNRAESECPGMNTHSRASCMQMDDVIDDIISLESSY |
Rabbit Polyclonal Anti-MITF Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MITF antibody: synthetic peptide directed towards the N terminal of human MITF. Synthetic peptide located within the following region: THLENPTKYHIQQAQRQQVKQYLSTTLANKHANQVLSLPCPNQPGDHVMP |
Anti-MITF Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 173 amino acids of human matrix metallopeptidase 28 |
Mouse Monoclonal MiTF Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Microphthalmia Transcription Factor (MITF) Mouse Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mitf Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
MiTF Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human MiTF |
Active filters
Target Symbol
- MITF