Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-MLKL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MLKL antibody: synthetic peptide directed towards the N terminal of human MLKL. Synthetic peptide located within the following region: DVWKELSLLLQVEQRMPVSPISQGASWAQEDQQDADEDRRAFQMLRRDNE |
MLKL Antibody - middle region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse MLKL |
MLKL rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MLKL |
MLKL Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of mouse MLKL |
| Modifications | Unmodified |
MLKL Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of mouse MLKL |
| Modifications | Unmodified |
MLKL Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MLKL |
| Modifications | Unmodified |
Phospho-MLKL-T357/S358/S360 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding T357/S358/S360 of human MLKL. |
| Modifications | Phospho T357/S358/S360 |
Phospho-MLKL-S358 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho synthetic peptide corresponding to residues surrounding S358 of human MLKL. |
| Modifications | Phospho S358 |
Phospho-MLKL-S345 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A phospho synthetic peptide corresponding to residues surrounding S345 of Mouse MLKL. |
| Modifications | Phospho S345 |
MLKL (5E3) Mouse monoclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
MLKL Rabbit monoclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- MLKL