Rabbit Polyclonal Anti-MLX Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MLX antibody: synthetic peptide directed towards the C terminal of human MLX. Synthetic peptide located within the following region: LRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFNVFQGIMDSLF |
Rabbit Polyclonal Anti-MLX Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MLX antibody: synthetic peptide directed towards the N terminal of human MLX. Synthetic peptide located within the following region: GSCENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRP |
Rabbit Polyclonal Anti-MLX Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MLX antibody: synthetic peptide directed towards the N terminal of human MLX. Synthetic peptide located within the following region: MTEPGASPEDPWVKASPVGAHAGEGRAGRARARRGAGRRGASLLSPKSPT |
Rabbit polyclonal anti-Mlx antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Mlx. |
MLX goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Bovine, Canine, Human, Mouse, Rat |
| Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_937848.1; NP_937847.1; NP_733752.1. |
MLX rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human MLX |
Rabbit Polyclonal Anti-MLX Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MLX Antibody: synthetic peptide directed towards the C terminal of human MLX. Synthetic peptide located within the following region: LRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFNVFQGIMDSLF |
Rabbit Polyclonal Anti-MLX Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MLX Antibody: synthetic peptide directed towards the N terminal of human MLX. Synthetic peptide located within the following region: AYSDNSLDPGLFVESTRKGSVVSRANSIGSTSASSVPNTDDEDSDYHQEA |
Rabbit Polyclonal Anti-MLX
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MLX antibody: synthetic peptide directed towards the middle region of human MLX. Synthetic peptide located within the following region: EVSTLRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFNVFQGIM |
Carrier-free (BSA/glycerol-free) MLX mouse monoclonal antibody,clone OTI1D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
MLX mouse monoclonal antibody,clone OTI1D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
MLX mouse monoclonal antibody,clone OTI1D11, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
MLX mouse monoclonal antibody,clone OTI1D11, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
MLX mouse monoclonal antibody,clone OTI1D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
