Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal MMP10 (Cleaved-Phe99) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human MMP10. |
Rabbit anti-MMP10 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human MMP10 |
Rabbit Polyclonal Anti-MMP10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MMP10 antibody: synthetic peptide directed towards the N terminal of human MMP10. Synthetic peptide located within the following region: MMHLAFLVLLCLPVCSAYPLSGAAKEEDSNKDLAQQYLEKYYNLEKDVKQ |
Rabbit anti MMP-10 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-MMP10 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 404-418 amino acids of Human matrix metallopeptidase 10 (stromelysin 2) |
Active filters
Target Symbol
- MMP10