Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 26 of 26 results

(reset)

MMP2 Rabbit Polyclonal Antibody

TA308925

USD 415.00

2 Weeks

Rabbit Polyclonal antibody to MMP2 (matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase))

Applications	IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 193 and 575 of MMP2 (Uniprot ID#P08253)

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

MMP2 Rabbit Polyclonal Antibody

TA326260

USD 345.00

In Stock

Rabbit polyclonal MMP-2 antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from human MMP-2.

1 / 2

2 / 2

Previous Next

MMP2 Rabbit Polyclonal Antibody

TA371261

USD 380.00

4 Weeks

MMP2 rabbit polyclonal antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human MMP2

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

MMP2 (C-term) Rabbit Polyclonal Antibody

AP23331PU-N

USD 405.00

2 Weeks

MMP2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminal of human MMP2

1 / 2

2 / 2

Previous Next

MMP2 Rabbit Polyclonal Antibody

TA332987

USD 275.00

3 Weeks

Rabbit anti-MMP2 Polyclonal Antibody

Applications	ICC/IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human MMP2

MMP2 Rabbit Polyclonal Antibody

TA347674

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-MMP2 Antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The immunogen for anti-MMP2 Antibody: A synthesized peptide derived from human MMP2

MMP2 Rabbit Polyclonal Antibody

TA350972

USD 345.00

In Stock

Rabbit Polyclonal Anti-MMP2 Antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human MMP2

MMP2 Rabbit Polyclonal Antibody

TA354278

USD 355.00

5 Days

Rabbit anti MMP-2 Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	A synthetic peptide corresponding to C-term of human MMP2. This sequence is identical among human, rat, mouse, chicken, dog and bovine.

1 / 2

2 / 2

Previous Next

Mmp2 Rabbit Polyclonal Antibody

AP26359PU-N

USD 395.00

3 Weeks

Mmp2 rabbit polyclonal antibody, Aff - Purified

Applications	IP, WB
Reactivities	Rat
Immunogen	E. coli-expressed active rat 72-kDa type IV collagenase

MMP2 Rabbit Polyclonal Antibody

TA330021

USD 310.00

5 Days

Rabbit Polyclonal Anti-MMP2 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-MMP2 antibody: synthetic peptide directed towards the C terminal of human MMP2. Synthetic peptide located within the following region: AWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWL

1 / 2

2 / 2

Previous Next

MMP2 Mouse Monoclonal Antibody [Clone ID: 4D3]

TA353336L

USD 1,140.00

9 Weeks

Mouse monoclonal Anti-MMP2 Clone 4D3

Applications	IHC, WB
Conjugation	Unconjugated

1 / 3

2 / 3

3 / 3

Previous Next

MMP2 Mouse Monoclonal Antibody [Clone ID: 8B4]

TA309751

USD 479.00

5 Days

Mouse Monoclonal MMP2 Antibody (8B4)

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

1 / 2

2 / 2

Previous Next

MMP2 Mouse Monoclonal Antibody [Clone ID: 2C1]

TA309752

USD 424.00

5 Days

Mouse Monoclonal MMP2 Antibody (2C1)

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

1 / 3

2 / 3

3 / 3

Previous Next

MMP2 Mouse Monoclonal Antibody [Clone ID: OTI4A11]

CF806846

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) MMP2 mouse monoclonal antibody, clone OTI4A11 (formerly 4A11)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

MMP2 Mouse Monoclonal Antibody [Clone ID: OTI4B11]

CF806847

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) MMP2 mouse monoclonal antibody, clone OTI4B11 (formerly 4B11)

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

MMP2 Rabbit Polyclonal Antibody

TA350971

USD 345.00

In Stock

Rabbit Polyclonal Anti-MMP2 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human MMP2

MMP2 Rabbit Polyclonal Antibody

TA350973

USD 345.00

In Stock

Rabbit Polyclonal Anti-MMP2 Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human MMP2

MMP2 Rabbit Polyclonal Antibody

TA378583

USD 220.00

3 Weeks

MMP2 Rabbit polyclonal Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 40-280 of human MMP2 (NP_004521.1).
Modifications	Unmodified

MMP2 Mouse Monoclonal Antibody [Clone ID: OTI4A11]

TA806846

USD 379.00

In Stock

MMP2 mouse monoclonal antibody, clone OTI4A11 (formerly 4A11)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

MMP2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4A11]

TA806846AM

USD 420.00

4 Weeks

MMP2 mouse monoclonal antibody, clone OTI4A11 (formerly 4A11), Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

MMP2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A11]

TA806846BM

USD 420.00

4 Weeks

MMP2 mouse monoclonal antibody, clone OTI4A11 (formerly 4A11), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

MMP2 Mouse Monoclonal Antibody [Clone ID: OTI4A11]

TA806846S

USD 159.00

2 Days

MMP2 mouse monoclonal antibody, clone OTI4A11 (formerly 4A11)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

MMP2 Mouse Monoclonal Antibody [Clone ID: OTI4B11]

TA806847

USD 379.00

In Stock

MMP2 mouse monoclonal antibody, clone OTI4B11 (formerly 4B11)

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

MMP2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4B11]

TA806847AM

USD 420.00

4 Weeks

MMP2 mouse monoclonal antibody, clone OTI4B11 (formerly 4B11), Biotinylated

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 2

2 / 2

Previous Next

MMP2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B11]

TA806847BM

USD 420.00

4 Weeks

MMP2 mouse monoclonal antibody, clone OTI4B11 (formerly 4B11), HRP conjugated

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 2

2 / 2

Previous Next

MMP2 Mouse Monoclonal Antibody [Clone ID: OTI4B11]

TA806847S

USD 159.00

2 Days

MMP2 mouse monoclonal antibody, clone OTI4B11 (formerly 4B11)

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

1 - 26 of 26 results