Germany
Japan
United Kingdom
China
MNAT1 Rabbit Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MNAT1 |
Antibodies
View as table Download
Rabbit polyclonal anti-MAT1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MAT1. |
Anti-MNAT1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-MNAT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MNAT1 antibody: synthetic peptide directed towards the N terminal of human MNAT1. Synthetic peptide located within the following region: DDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGT |
Rabbit Polyclonal Anti-MNAT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MNAT1 Antibody: synthetic peptide directed towards the C terminal of human MNAT1. Synthetic peptide located within the following region: LQIETYGPHVPELEMLGRLGYLNHVRAASPQDLAGGYTSSLACHRALQDA |
Active filters
Target Symbol
- MNAT1