Rabbit polyclonal MORC3 Antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MORC3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 634-663 amino acids from the Central region of human MORC3. |
Rabbit Polyclonal Anti-MORC3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MORC3 antibody: synthetic peptide directed towards the N terminal of human MORC3. Synthetic peptide located within the following region: KLLAELDAIIGKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDEIT |
MORC3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 640-939 of human MORC3 (NP_056173.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
