Antibodies

Jump to Filters
View as table Download
MPIG6B Rabbit Polyclonal Antibody
TA339555

USD 375.00

5 Days

Rabbit Polyclonal Anti-C6orf25 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C6orf25 antibody: synthetic peptide directed towards the N terminal of human C6orf25. Synthetic peptide located within the following region: AVFLQLLPLLLSRAQGNPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFP
MPIG6B Rabbit Polyclonal Antibody
TA353007L

USD 1,255.00

5 Days

Rabbit polyclonal anti-Human G6b-B antibody

Reactivities Human
Immunogen Human G6b-B