Antibodies

View as table Download

Rabbit Polyclonal Anti-MPO Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human MPO

Myeloperoxidase (MPO) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to a sequence mapping at the C-terminal of Human MPO

Myeloperoxidase (MPO) mouse monoclonal antibody, clone 266.6K2, FITC

Applications FC, IF
Reactivities Human
Conjugation FITC

Myeloperoxidase (MPO) mouse monoclonal antibody, clone 266.6K2, Aff - Purified

Applications FC, IF, IHC
Reactivities Human

Rabbit Polyclonal Anti-MPO Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MPO antibody: synthetic peptide directed towards the N terminal of human MPO. Synthetic peptide located within the following region: QLNVLSKSSGCAYQDVGVTCPEQDKYRTITGMCNNRRSPTLGASNRAFVR

Myeloperoxidase (MPO) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 66-97aa) of human Myeloperoxidase

Myeloperoxidase (MPO) rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Immunogen Purified human granulocytic MPO

Myeloperoxidase (MPO) rabbit polyclonal antibody, Aff - Purified

Applications ELISA
Reactivities Human
Immunogen Native human Myeloperoxidase purified from human Neutrophils

Myeloperoxidase (MPO) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 547-575 amino acids from the C-terminal region of Human Myeloperoxidase.

Rabbit polyclonal anti-Myeloperoxidase (MPO) antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 765 of human MPO

Rabbit polyclonal Myeloperoxidase antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Myeloperoxidase [Human Leukocytes]

Rabbit Polyclonal Myeloperoxidase Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

MPO Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse MPO

Myeloperoxidase (MPO) Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 50-310 of human Myeloperoxidase (MPO) (NP_000241.1).
Modifications Unmodified