Antibodies

View as table Download

Rabbit polyclonal anti-MRPL4 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MRPL4.

Rabbit Polyclonal Anti-MRPL4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MRPL4 Antibody is: synthetic peptide directed towards the N-terminal region of Human MRPL4. Synthetic peptide located within the following region: YAKTKTRAEVRGGGRKPWPQKGTGRARHGSIRSPLWRGGGVAHGPRGPTS