Rabbit Polyclonal Anti-MRPS33 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Mrps33 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DWYPNHNTYFALMGNLRFLGLYRDEHQDFKDEQRRLKKLRGKGKPRKGEG |
Rabbit polyclonal anti-MRPS33 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MRPS33. |
MRPS33 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human RT33 |
MRPS33 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-106 of human MRPS33 (NP_057155.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China