Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-MRPS36 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MRPS36 antibody is: synthetic peptide directed towards the middle region of Human MRPS36. Synthetic peptide located within the following region: SHSSVISQHSKGSKSPDLLMYQGPPDTAEIIKTLPQKYRRKLVSQEEMEF |
Rabbit Polyclonal Anti-MRPS36 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MRPS36 antibody is: synthetic peptide directed towards the N-terminal region of Human MRPS36. Synthetic peptide located within the following region: RFPDRRDNPKPNVSEALRSAGLPSHSSVISQHSKGSKSPDLLMYQGPPDT |
MRPS36 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MRPS36 |
Active filters
Target Symbol
- MRPS36