Rabbit Polyclonal Anti-MSL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MSL2L1 antibody: synthetic peptide directed towards the N terminal of human MSL2L1. Synthetic peptide located within the following region: NPVNATALYISASRLVLNYDPGDPKAFTEINRLLPYFRQSLSCCVCGHLL |
Carrier-free (BSA/glycerol-free) MSL2 mouse monoclonal antibody,clone OTI6C10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MSL2 mouse monoclonal antibody,clone OTI3B11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MSL2 mouse monoclonal antibody,clone OTI3G5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
MSL2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 328-577 of human MSL2 (NP_060603.2). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
MSL2 mouse monoclonal antibody,clone OTI6C10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
MSL2 mouse monoclonal antibody,clone OTI6C10, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
MSL2 mouse monoclonal antibody,clone OTI6C10, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
MSL2 mouse monoclonal antibody,clone OTI6C10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
MSL2 mouse monoclonal antibody,clone OTI3B11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
MSL2 mouse monoclonal antibody,clone OTI3B11, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
MSL2 mouse monoclonal antibody,clone OTI3B11, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
MSL2 mouse monoclonal antibody,clone OTI3B11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
MSL2 mouse monoclonal antibody,clone OTI3G5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
MSL2 mouse monoclonal antibody,clone OTI3G5, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
MSL2 mouse monoclonal antibody,clone OTI3G5, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
MSL2 mouse monoclonal antibody,clone OTI3G5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
