Rabbit polyclonal Anti-MYBPH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYBPH antibody: synthetic peptide directed towards the middle region of human MYBPH. Synthetic peptide located within the following region: APKIRVPRHLRQTYIRQVGETVNLQIPFQGKPKPQATWTHNGHALDSQRV |
Rabbit polyclonal Anti-MYBPH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYBPH antibody: synthetic peptide directed towards the N terminal of human MYBPH. Synthetic peptide located within the following region: LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP |
Carrier-free (BSA/glycerol-free) MYBPH mouse monoclonal antibody, clone OTI2A3 (formerly 2A3)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
MYBPH mouse monoclonal antibody, clone OTI2A3 (formerly 2A3)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
MYBPH mouse monoclonal antibody,clone 2A3, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Biotin |
MYBPH mouse monoclonal antibody,clone 2A3, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | HRP |
MYBPH mouse monoclonal antibody, clone OTI2A3 (formerly 2A3)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
