Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal MYCT1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | MYCT1 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human MYCT1. |
Rabbit Polyclonal Anti-MYCT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MYCT1 antibody is: synthetic peptide directed towards the middle region of Human MYCT1. Synthetic peptide located within the following region: RRRRASAPISQWSSSRRSRSSYTHGLNRTGFYRHSGCERRSNLSLASLTF |
MYCT1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 99-235 of human MYCT1 (NP_079383.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- MYCT1