Antibodies

Jump to Filters
View as table Download
FUS2 (NAT6) Rabbit Polyclonal Antibody
TA346764

USD 475.00

5 Days

Rabbit Polyclonal Anti-NAT6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NAT6 antibody: synthetic peptide directed towards the C terminal of human NAT6. Synthetic peptide located within the following region: GYQLGEPVQGLVFTSRRLPATLLNAFPTAPSPRPPRKAPNLTAQAAPRGP
FUS2 (NAT6) Rabbit Polyclonal Antibody
TA308604

USD 415.00

5 Days

Rabbit Polyclonal antibody to FUS2 (N-acetyltransferase 6 (GCN5-related))

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 224 and 286 of FUS2 (Uniprot ID#Q93015)