Antibodies

Jump to Filters
View as table Download
NAT8B Rabbit Polyclonal Antibody
TA346134

USD 475.00

5 Days

Rabbit Polyclonal Anti-NAT8B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NAT8B antibody: synthetic peptide directed towards the middle region of human NAT8B. Synthetic peptide located within the following region: SCFWVGESEEKVVGTVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKA
NAT8B Rabbit Polyclonal Antibody
TA378937

USD 220.00

3 Weeks

NAT8B Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 75-165 of human NAT8B (NP_057431.2).
Modifications Unmodified