Antibodies

Jump to Filters
View as table Download
BRRN1 (NCAPH) Goat Polyclonal Antibody
TA303239

USD 375.00

In Stock

Goat Polyclonal Antibody against NCAPH

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TEDLSDVLVRQGD, from the C Terminus of the protein sequence according to NP_056156.2.
BRRN1 (NCAPH) Rabbit Polyclonal Antibody
TA312713

USD 345.00

In Stock

Rabbit polyclonal anti-NCAPH antibody

Applications WB
Reactivities Human (Identities = 100%, Positives = 100%
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NCAPH.
BRRN1 (NCAPH) Rabbit Polyclonal Antibody
AP21157PU-N

USD 370.00

2 Weeks

BRRN1 (NCAPH) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
BRRN1 (NCAPH) Rabbit Polyclonal Antibody
TA339327

USD 375.00

5 Days

Rabbit Polyclonal Anti-NCAPH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NCAPH antibody: synthetic peptide directed towards the N terminal of human NCAPH. Synthetic peptide located within the following region: MPLPRKAPLNIPGTPVLEDFPQNDDEKERLQRRRSRVFDLQFSTDSPRLL
BRRN1 (NCAPH) Rabbit Polyclonal Antibody
TA339328

USD 375.00

5 Days

Rabbit Polyclonal Anti-NCAPH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NCAPH antibody: synthetic peptide directed towards the C terminal of human NCAPH. Synthetic peptide located within the following region: TKDLQRSLPPVMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVRQG
BRRN1 (NCAPH) Rabbit Polyclonal Antibody
TA361726

USD 360.00

5 Days

NCAPH Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human NCAPH
NCAPH Rabbit Polyclonal Antibody
TA365533

USD 380.00

4 Weeks

NCAPH rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human NCAPH
NCAPH Rabbit Polyclonal Antibody
TA369846

USD 380.00

4 Weeks

NCAPH rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human NCAPH
BRRN1 (NCAPH) Rabbit Polyclonal Antibody
TA378951

USD 220.00

3 Weeks

NCAPH Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human NCAPH (NP_056156.2).
Modifications Unmodified