Germany
Japan
United Kingdom
China
NCR1 mouse monoclonal antibody, clone B-L46, Azide Free
| Applications | FC, FN |
| Reactivities | Human |
Antibodies
View as table Download
NCR1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human NCR1 |
Rabbit Polyclonal Anti-Gps2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Gps2 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Gps2. Synthetic peptide located within the following region: LKKVLHEEEKRRRKEQSDLTTLTSAAYQQSLTVHTGTHLLNMQGSPGGHN |
NCR1 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
Rabbit polyclonal anti-NCR1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NCR1. |
NCR1 mouse monoclonal antibody, clone B-N40, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
NCR1 mouse monoclonal antibody, clone B-N40, Azide Free
| Applications | FC |
| Reactivities | Human |
NCR1 mouse monoclonal antibody, clone B-N40, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
NCR1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
NCR1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
NCR1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 151-303 of human NCR1 (NP_001138929.2). |
| Modifications | Unmodified |
NCR1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 151-303 of human NCR1 (NP_001138929.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- NCR1