Antibodies

Jump to Filters
View as table Download
NEK11 Rabbit Polyclonal Antibody
TA346831

USD 475.00

5 Days

Rabbit Polyclonal Anti-NEK11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NEK11 antibody: synthetic peptide directed towards the middle region of human NEK11. Synthetic peptide located within the following region: KEIRNEGSQPAYRTNQQDSDIEALARCLENVLGCTSLDTKTITTMAEDMS
NEK11 Mouse Monoclonal Antibody [Clone ID: OTI4H5]
CF501583

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) NEK11 mouse monoclonal antibody, clone OTI4H5 (formerly 4H5)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
NEK11 Mouse Monoclonal Antibody [Clone ID: OTI5E9]
CF501608

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) NEK11 mouse monoclonal antibody, clone OTI5E9 (formerly 5E9)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
NEK11 Mouse Monoclonal Antibody [Clone ID: OTI5D9]
CF501765

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) NEK11 mouse monoclonal antibody, clone OTI5D9 (formerly 5D9)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
NEK11 Rabbit Polyclonal Antibody
TA349609

USD 345.00

In Stock

Rabbit Polyclonal Anti-NEK11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human NEK11
NEK11 Rabbit Polyclonal Antibody
TA356755

USD 360.00

5 Days

NEK11 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human NEK11
NEK11 Rabbit Polyclonal Antibody
TA362297

USD 360.00

5 Days

NEK11 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human NEK11
NEK11 Mouse Monoclonal Antibody [Clone ID: OTI4H5]
TA501583

USD 379.00

In Stock

Anti-NEK11 mouse monoclonal antibody, clone OTI4H5 (formerly 4H5)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
NEK11 Mouse Monoclonal Antibody [Clone ID: OTI4H5]
TA501583S

USD 159.00

In Stock

Anti-NEK11 mouse monoclonal antibody, clone OTI4H5 (formerly 4H5)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
NEK11 Mouse Monoclonal Antibody [Clone ID: OTI5E9]
TA501608

USD 379.00

In Stock

Anti-NEK11 mouse monoclonal antibody, clone OTI5E9 (formerly 5E9)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
NEK11 Mouse Monoclonal Antibody [Clone ID: OTI5E9]
TA501608S

USD 159.00

2 Days

Anti-NEK11 mouse monoclonal antibody, clone OTI5E9 (formerly 5E9)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
NEK11 Mouse Monoclonal Antibody [Clone ID: OTI5D9]
TA501765

USD 379.00

In Stock

NEK11 mouse monoclonal antibody, clone OTI5D9 (formerly 5D9)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
NEK11 Mouse Monoclonal Antibody [Clone ID: OTI5D9]
TA501765S

USD 159.00

2 Days

NEK11 mouse monoclonal antibody, clone OTI5D9 (formerly 5D9)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated