Antibodies

View as table Download

NEK7 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human NEK7

Goat Anti-NEK7 (aa 274-286) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence CINPDPEKRPDVT, from the C Terminus of the protein sequence according to NP_598001.1.

Rabbit Polyclonal antibody to NEK7 (NIMA (never in mitosis gene a)-related kinase 7)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 238 and 302 of NEK7 (Uniprot ID#Q8TDX7)

Rabbit polyclonal anti-NEK7 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NEK7 antibody: synthetic peptide directed towards the N terminal of human NEK7. Synthetic peptide located within the following region: KARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMI

Nek7 Antibody - C-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated

NEK7 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human NEK7