Antibodies

Jump to Filters
View as table Download
Neo1 Rabbit Polyclonal Antibody
TA341799

USD 375.00

5 Days

Rabbit Polyclonal Anti-Neo1 Antibody

Applications WB
Reactivities Mouse
Immunogen The immunogen for Anti-Neo1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Neo1. Synthetic peptide located within the following region: PPPPLLLLLPLLLLLGRPASGAAATKSGSPPQSAGASVRTFTPFYFLVEP
Neogenin (NEO1) Rabbit Polyclonal Antibody
TA379057

USD 220.00

3 Weeks

NEO1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 160-340 of human NEO1 (NP_002490.2).
Modifications Unmodified