Rabbit Polyclonal Anti-NDF2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NDF2 Antibody: A synthesized peptide derived from human NDF2 |
Rabbit Polyclonal Anti-NDF2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NDF2 Antibody: A synthesized peptide derived from human NDF2 |
Rabbit polyclonal anti-NDF2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDF2. |
Rabbit Polyclonal Anti-NEUROD2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NEUROD2 antibody: synthetic peptide directed towards the N terminal of human NEUROD2. Synthetic peptide located within the following region: AEVKEEGELGGEEEEEEEEEEGLDEAEGERPKKRGPKKRKMTKARLERSK |
Rabbit Polyclonal Anti-NEUROD2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NEUROD2 antibody: synthetic peptide directed towards the C terminal of human NEUROD2. Synthetic peptide located within the following region: PGSRPTGHGLVFGSSAVRGGVHSENLLSYDMHLHHDRGPMYEELNAFFHN |