Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal NFAT3 (Ab-676) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human NFAT3 around the phosphorylation site of serine 676 (K-R-SP-P-T). |
NFATC4 goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Canine, Human, Mouse, Porcine, Rat |
| Immunogen | Peptide with sequence from the C Terminus of the protein sequence according to NP_004545.2, NP_001185894.1, NP_001185895.1, NP_001185896.1. |
Rabbit polyclonal NFATC4 Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NFATC4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 744-773 amino acids from the C-terminal region of human NFATC4. |
Rabbit Polyclonal Anti-NFATC4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFATC4 antibody: synthetic peptide directed towards the middle region of human NFATC4. Synthetic peptide located within the following region: GEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLTV |
NFATC4 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
Rabbit Polyclonal Anti-NFATC4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFATC4 antibody: synthetic peptide directed towards the N terminal of human NFATC4. Synthetic peptide located within the following region: RGPEDSWLLLSAPGPTPASPRPASPCGKRRYSSSGTPSSASPALSRRGSL |
Rabbit Polyclonal Anti-NFATC4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFATC4 antibody: synthetic peptide directed towards the N terminal of human NFATC4. Synthetic peptide located within the following region: MGAASCEDEELEFKLVFGEEKEAPPLGAGGLGEELDSEDAPPCCRLALGE |
Anti-NFATC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 420-434 amino acids of human nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 4 |
Anti-NFATC4 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 420-434 amino acids of human nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 4 |
NFATC4 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human NFATC4 |
NFATC4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 560-710 of human NFATC4 (NP_004545.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- NFATC4