Antibodies

View as table Download

Rabbit Polyclonal Anti-NFE2 Antibody - middle region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NFE2 antibody: synthetic peptide directed towards the middle region of human NFE2. Synthetic peptide located within the following region: KPLSLSGLLSEPLQDPLALLDIGLPAGPPKPQEDPESDSGLSLNYSDAES

Rabbit Polyclonal anti-Nfe2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Nfe2 antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Nfe2. Synthetic peptide located within the following region: ARGEADRTLEVMRQQLAELYHDIFQHLRDESGNSYSPEEYVLQQAADGAI

Rabbit Polyclonal anti-NFE2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NFE2 antibody: synthetic peptide directed towards the N terminal of human NFE2. Synthetic peptide located within the following region: MSPCPPQQSRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPSFEP