Rabbit Polyclonal Anti-NFE2 Antibody - middle region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFE2 antibody: synthetic peptide directed towards the middle region of human NFE2. Synthetic peptide located within the following region: KPLSLSGLLSEPLQDPLALLDIGLPAGPPKPQEDPESDSGLSLNYSDAES |
Rabbit Polyclonal anti-Nfe2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Nfe2 antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Nfe2. Synthetic peptide located within the following region: ARGEADRTLEVMRQQLAELYHDIFQHLRDESGNSYSPEEYVLQQAADGAI |
Rabbit Polyclonal anti-NFE2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFE2 antibody: synthetic peptide directed towards the N terminal of human NFE2. Synthetic peptide located within the following region: MSPCPPQQSRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPSFEP |
Germany
Japan
United Kingdom
China