Antibodies

Jump to Filters
View as table Download
NFIB Rabbit Polyclonal Antibody
TA331122

USD 310.00

5 Days

Rabbit Polyclonal Anti-NFIB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NFIB antibody: synthetic peptide directed towards the middle region of human NFIB. Synthetic peptide located within the following region: QDSGQSGSPSHNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTG
NFIB Rabbit Polyclonal Antibody
TA379084

USD 220.00

3 Weeks

NFIB Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human NFIB (NP_005587.2).
Modifications Unmodified