Rabbit polyclonal NFIC Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NFIC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 180-208 amino acids from the Central region of human NFIC. |
Rabbit Polyclonal Anti-NFIC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFIC antibody: synthetic peptide directed towards the middle region of human NFIC. Synthetic peptide located within the following region: KSPFNSPSPQDSPRLSSFTQHHRPVIAVHSGIARSPHPSSALHFPTTSIL |
Rabbit Polyclonal Anti-NFIC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFIC antibody: synthetic peptide directed towards the middle region of human NFIC. Synthetic peptide located within the following region: MLAPPPPGLPRLALPPATKPATTSEGGATSPTSPSYSPPDTSPANRSFVG |
Rabbit Polyclonal Anti-NFIC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFIC antibody: synthetic peptide directed towards the C terminal of human NFIC. Synthetic peptide located within the following region: VRERDAEQSGSPRTGMGSDQEDSKPITLDTTDFQESFVTSGVFSVTELIQ |
Rabbit Polyclonal Anti-NFIC Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NFIC antibody is: synthetic peptide directed towards the N-terminal region of Human NFIC. Synthetic peptide located within the following region: MDEFHPFIEALLPHVRAFAYTWFNLQARKRKYFKKHEKRMSKDEERAVKD |
Nfic Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Nfic |
NFIC Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human NFIC (NP_005588.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
