Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-NFYA antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NFYA. |
Antibodies
View as table Download
Rabbit Polyclonal anti-NFYA antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFYA antibody: synthetic peptide directed towards the C terminal of human NFYA. Synthetic peptide located within the following region: YLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS |
Rabbit Polyclonal anti-NFYA antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFYA antibody: synthetic peptide directed towards the C terminal of human NFYA. Synthetic peptide located within the following region: YLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS |
Rabbit polyclonal anti-NF-Y antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Anti-NF-Y (A) antibody was produced by repeated immunizations with a synthetic NF-Y (A subunit) peptide corresponding to a region near the N-terminus of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
NFYA Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-318 of human NFYA (NP_068351.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- NFYA