Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-NKX2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NKX2-2 antibody: synthetic peptide directed towards the N terminal of human NKX2-2. Synthetic peptide located within the following region: MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQ |
Nkx2.2 (NKX2-2) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide - KLH conjugated - corresponding to the central region (between 98-128aa) of human NKX2-2 |
Rabbit Polyclonal Anti-NKX2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NKX2-2 antibody is: synthetic peptide directed towards the N-terminal region of Human NKX2-2. Synthetic peptide located within the following region: GLAAGAPPQDSSSKSPEPSADESPDNDKETPGGGGDAGKKRKRRVLFSKA |
Rabbit Polyclonal Anti-NKX2-2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NKX2-2 Antibody: synthetic peptide directed towards the N terminal of human NKX2-2. Synthetic peptide located within the following region: MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQ |
Rabbit Polyclonal Anti-NKX2-2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NKX2-2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EGPEEESEGPEPAKRAGPLGQGALDAVQSLPLKSPFYDSSDNPYTRWLAS |
NKX2-2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human NKX2-2 (NP_002500.1). |
Active filters
Target Symbol
- NKX2-2