Germany
Japan
United Kingdom
China
Rabbit anti-NKX2-5 Polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human NKX2-5 |
Antibodies
View as table Download
Rabbit Polyclonal antibody to Nkx2.5 (NK2 transcription factor related, locus 5 (Drosophila))
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 218 of Nkx2.5 (Uniprot ID#P52952) |
Rabbit Polyclonal anti-Nkx2
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Nkx2-5 antibody: synthetic peptide directed towards the n terminal of human Nkx2-5. Synthetic peptide located within the following region: ELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVE |
Rabbit Polyclonal Anti-Nkx2-5 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Nkx2-5 antibody: synthetic peptide directed towards the n terminal of mouse Nkx2-5. Synthetic peptide located within the following region: MFPSPALTPTPFSVKDILNLEQQQRSLASGDLSARLEATLAPASCMLAAF |
NKX2-5 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NKX2-5 |
NKX2-5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human NKX2-5 (NP_004378.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- NKX2-5